PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA13G00088
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family MYB
Protein Properties Length: 129aa    MW: 14979.1 Da    PI: 10.0651
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA13G00088genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding61.12.3e-191055147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W+ eEde+l ++v+++G+++W+ I+  ++ gR++k+c++rw + 
       AA13G00088 10 KGPWSREEDEQLQELVEKHGPKNWSVISGLIP-GRSPKSCRLRWCNQ 55
                     79******************************.***********985 PP

2Myb_DNA-binding48.22.5e-1564106347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eEd++++++ ++lG++ W+ Iar +   R+++ +k+rw++ 
       AA13G00088  64 PWTAEEDQIIIRGRAELGNR-WAVIARSLH-LRSDNAVKNRWNST 106
                      8*******************.*********.9**********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.881560IPR017930Myb domain
SuperFamilySSF466891.22E-308103IPR009057Homeodomain-like
SMARTSM007176.2E-17958IPR001005SANT/Myb domain
PfamPF002497.1E-191055IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-261163IPR009057Homeodomain-like
CDDcd001671.50E-141254No hitNo description
SMARTSM007171.5E-1461109IPR001005SANT/Myb domain
PROSITE profilePS5129417.18361111IPR017930Myb domain
CDDcd001671.51E-1064107No hitNo description
PfamPF002499.7E-1464106IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.0E-2164110IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 129 aa     Download sequence    Send to blast
MCTLTVEAVK GPWSREEDEQ LQELVEKHGP KNWSVISGLI PGRSPKSCRL RWCNQLSPEV  60
KHRPWTAEED QIIIRGRAEL GNRWAVIARS LHLRSDNAVK NRWNSTLKRQ FRLSRCNVDN  120
LMSFDLSNT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A6e-3771111105MYB PROTO-ONCOGENE PROTEIN
1h89_C1e-36311151159MYB PROTO-ONCOGENE PROTEIN
1h88_C1e-36311151159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009136534.17e-51PREDICTED: transcription factor MYB44-like
RefseqXP_013593223.18e-51PREDICTED: transcription factor MYB44-like
SwissprotQ9FDW17e-49MYB44_ARATH; Transcription factor MYB44
TrEMBLA0A0D3DDR78e-51A0A0D3DDR7_BRAOL; Uncharacterized protein
TrEMBLM4D8V08e-51M4D8V0_BRARP; Uncharacterized protein
STRINGBra012910.1-P2e-50(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM67728135
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G50060.16e-52myb domain protein 77